PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.003G357300.1.p
Common NameSb03g039950, SORBIDRAFT_03g039950
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 400aa    MW: 42815.7 Da    PI: 5.7568
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.003G357300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.33.5e-1895140147
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                           rg+W++eEd  l ++v++lG ++W++Iar ++ gR++k+c++rw + 
  Sobic.003G357300.1.p  95 RGPWSPEEDTVLSNLVEKLGARNWTLIARGIP-GRSGKSCRLRWCNQ 140
                           89******************************.***********985 PP

2Myb_DNA-binding48.52e-15147191147
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                           r+++T+eEd ++  a++ +G++ W+ Ia+ +  gRt++ +k++w++ 
  Sobic.003G357300.1.p 147 RKPFTEEEDRIIMAAHAVHGNK-WACIAKLLD-GRTDNAIKNHWNST 191
                           789*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.88690145IPR017930Myb domain
SuperFamilySSF466891.69E-3093188IPR009057Homeodomain-like
SMARTSM007171.1E-1494143IPR001005SANT/Myb domain
PfamPF002493.9E-1795140IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.8E-2696148IPR009057Homeodomain-like
CDDcd001673.91E-1497139No hitNo description
PROSITE profilePS5129421.454146196IPR017930Myb domain
SMARTSM007171.8E-13146194IPR001005SANT/Myb domain
PfamPF002493.2E-13147191IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-23149195IPR009057Homeodomain-like
CDDcd001672.44E-10149192No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 400 aa     Download sequence    Send to blast
MSAAETAVSP APQPPSDPNA AANADAAHSN SFSMADEAQT LTEALLQPQP NHMSPPPSGE  60
EDDGVTASGA PVGGDAAASA AAAAAANATM EERVRGPWSP EEDTVLSNLV EKLGARNWTL  120
IARGIPGRSG KSCRLRWCNQ LDPQVKRKPF TEEEDRIIMA AHAVHGNKWA CIAKLLDGRT  180
DNAIKNHWNS TLRRRYCNDG RCKHGGSVQR SILEVSRAVS EEPWPSKDLS SFNAMDVSDA  240
PVQTVPETSA GAWHITDQCS MTQGVDPPYL SRPAAKIGAF RPYNLGHTEP TQQEIPSSVV  300
KSDSTHKVLT PESEVFKFVD PICFSAEVPS KCGHGCCGAH KQPRKNSLLG PEFNEFEDHP  360
PILNTSFASL VSEISSIAWM RSGMQSSDAS TLFQSVPPT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-40941956107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0417270.0BT041727.2 Zea mays full-length cDNA clone ZM_BFb0040C04 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002458769.10.0hypothetical protein SORBIDRAFT_03g039950
TrEMBLC5XPU10.0C5XPU1_SORBI; Putative uncharacterized protein Sb03g039950
STRINGSb03g039950.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP89903647
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55730.16e-79myb domain protein 109